PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 293aa    MW: 33481.6 Da    PI: 5.7236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020295.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.67.1e-192269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++++G g+W++ a++ g++Rt+k+c++rw++yl
      Pbr020295.1 22 RGPWTLEEDRLLIQYIERHGEGQWNLLAKRSGLRRTGKSCRLRWLNYL 69
                     89********************************************97 PP

2Myb_DNA-binding53.46.1e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
      Pbr020295.1  75 RGNLSPEEQLLILDLHSKMGNR-WSKIAQYLP-GRTDNEIKNYWRT 118
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.2411773IPR017930Myb domain
SuperFamilySSF466899.54E-3220116IPR009057Homeodomain-like
SMARTSM007179.6E-172171IPR001005SANT/Myb domain
PfamPF002491.5E-172269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-232376IPR009057Homeodomain-like
CDDcd001671.80E-132469No hitNo description
PROSITE patternPS0017503746IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
SMARTSM007179.7E-1674122IPR001005SANT/Myb domain
PROSITE profilePS5129421.49274124IPR017930Myb domain
PfamPF002491.9E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2477123IPR009057Homeodomain-like
CDDcd001674.38E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSTNTKTLSS NCSGEDDSEL RRGPWTLEED RLLIQYIERH GEGQWNLLAK RSGLRRTGKS  60
CRLRWLNYLK PDVKRGNLSP EEQLLILDLH SKMGNRWSKI AQYLPGRTDN EIKNYWRTRM  120
HKQARHLNID MKSREFQNMI RCFWMPRLKQ KIGGETSISS AVLNQNPTIS QPLENNTVQH  180
LTATVSQPPQ ILVLEEINMS GTMYNLDVEK QNTEADYCTS SCIFPSEPVD MSKTAQFPEC  240
PPFYCGDNSG NDMESFNLQE SVSADSAPNF PGNSAGDCYV AENNWFDSDF FM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28191244108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2678990.0DQ267899.1 Malus x domestica cultivar Royal Gala MYB8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347244.10.0PREDICTED: transcription factor WER-like
TrEMBLQ0QMQ90.0Q0QMQ9_MALDO; MYB8
STRINGPOPTR_0015s03770.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.11e-72myb domain protein 116